View larger

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_03581 (OsI_03581)

CSB-CF490237OFF

Recombinant Oryza sativa subsp. indica CASP-like protein OsI_03581 (OsI_03581)

See below for Detailed Description

More details

CAD$1,550.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. indica (Rice)

Uniprot NO.:B8A927

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGSIGNGRNGSEVGIQIPAMGNKEVLERPAIPRWPRLGVVMVATRAVALVMAVLSMALMI SAKQRGSLKIFGIEIPLYANWSFSDSLEYLVGMSAVSAAYCLAQLLLTAHKAVKNAPVVQ SRNYAWLLFTGDQIFAYAMMSAGSAAAAVANLNRTGIRHTALPNFCKPLPRFCDLSAASI ACAFLSCIFLAASAVIDVIWLSNM

Protein Names:Recommended name: CASP-like protein OsI_03581

Gene Names:ORF Names:OsI_03581

Expression Region:1-204

Sequence Info:full length protein

30 other products in the same category: