View larger

Recombinant Vitis vinifera CASP-like protein VIT_10s0092g00220 (VIT_10s0092g00220)

CSB-CF417840VFQ

Recombinant Vitis vinifera CASP-like protein VIT_10s0092g00220 (VIT_10s0092g00220)

See below for Detailed Description

More details

CAD$1,550.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7QC16

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASKGEEKPELVGSKQGIVSVTKAKHDQIVLVLRVVAFLATASATIVMGLNQETKTLLVG TIGTTPIRATLKAKFQHTPAFVFFVVANGLASVYNLVMLGVDVFGRKLDCKGLRLVIISI LDMVIVAVVAAGASSAAFMAELGKNGNSHAKWNKICDKFESFCHQGGGALIPSFIALLLL FLISAISIITLHNQKLTSPHATTP

Protein Names:Recommended name: CASP-like protein VIT_10s0092g00220

Gene Names:Ordered Locus Names:VIT_10s0092g00220 ORF Names:GSVIVT00035198001, GSVIVT01037957001, VIT_00037957001, VITISV_004162, Vv10s0092g00220

Expression Region:1-204

Sequence Info:full length protein

30 other products in the same category: