View larger

Recombinant Vanderwaltozyma polyspora Autophagy-related protein 33(ATG33)

CSB-CF414537VDW

Recombinant Vanderwaltozyma polyspora Autophagy-related protein 33(ATG33)

See below for Detailed Description

More details

CAD$1,550.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Uniprot NO.:A7THN6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVCLGVTKTIAVSSLGLYAGLLTTTTLVTASAPIDLLLPRTNENPIVNYFKSIVCSVGK ISTVLSGLSTIFFGASYFGSPLSLRHPYLIYGMVIAPISAAYLYGASLFAHRHPSADQEK NNSPSPALDDSTVDLGKDFKHPKITPGEAGKCPFGSKTSIEASSESSRKNCNASIVAHLS VVTVFTILGFVQSVVGLYGEGHFV

Protein Names:Recommended name: Autophagy-related protein 33

Gene Names:Name:ATG33 ORF Names:Kpol_543p32

Expression Region:1-204

Sequence Info:full length protein

30 other products in the same category: