View larger

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG028 homolog (MPN_031)

CSB-CF302703MLW

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG028 homolog (MPN_031)

See below for Detailed Description

More details

CAD$1,549.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75083

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRRNWREHYNVFVANLALVLGFMLNIVVARYTLTGATPQARFLFLTPFLGIVAASIFYFF DVKWFLADYPYKKFHFQKKWTWTYLSGVFVFFANILVNVILLALLVNQMTNQILSEKYTG LLDNAYPLLWSAVGVSIFLSLISIGLSKTAHFKIDVEMLKAKKGEPTAADKTDSRPVVVD LDQTKSKKDGDNPPQASGDMTSL

Protein Names:Recommended name: Uncharacterized protein MG028 homolog

Gene Names:Ordered Locus Names:MPN_031 ORF Names:B01_orf203, MP123

Expression Region:1-203

Sequence Info:full length protein

30 other products in the same category: