View larger

Recombinant Probable cytochrome c oxidase subunit 3(ctaE)

CSB-CF744833MLA

Recombinant Probable cytochrome c oxidase subunit 3(ctaE)

See below for Detailed Description

More details

CAD$1,549.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium paratuberculosis

Uniprot NO.:Q73YM3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFTARAQSGGKWPP PPTELNLYQAVPVTLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQGYE YYHLMGHGTTIPGSAYGSVFYLATGFHDLHVTGGLVAFIFLLARTAMSKFTPAQATASIV VSYYWHFVDIVWIALFTVIYFIR

Protein Names:Recommended name: Probable cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 3 Cytochrome c oxidase polypeptide III

Gene Names:Name:ctaE Ordered Locus Names:MAP_1932

Expression Region:1-203

Sequence Info:full length protein

30 other products in the same category: