View larger

Recombinant Tic20 family protein Ycf60(ycf60)

CSB-CF636291EXX

Recombinant Tic20 family protein Ycf60(ycf60)

See below for Detailed Description

More details

CAD$1,549.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Porphyra yezoensis

Uniprot NO.:Q1XDC7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIRLFTFAIITVFLIVISRLALQRAYKYIKLNKKINNTESKTRLSIRLVSTVPYYLPLFE GLQNFGQYVLPDYPVAAIPLYKKIILPMLIFYMNHAILGLVTFFALYYVLVRNKSPIPVH QLVRFNSMQSILLFLVGSLFGAVFRAFPIEFRISFLGLMVCNMMFWFVLSTITYSIVKAV QGKYSNIPVISEAVRIQISGYST

Protein Names:Recommended name: Tic20 family protein Ycf60

Gene Names:Name:ycf60

Expression Region:1-203

Sequence Info:full length protein

30 other products in the same category: