View larger

Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 1(ARL6IP1)

CSB-CF614878HU

Recombinant Human ADP-ribosylation factor-like protein 6-interacting protein 1(ARL6IP1)

See below for Detailed Description

More details

CAD$1,549.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q15041

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII LKYIGMAKREINKLLKQKEKKNE

Protein Names:Recommended name: ADP-ribosylation factor-like protein 6-interacting protein 1 Short name= ARL-6-interacting protein 1 Short name= Aip-1

Gene Names:Name:ARL6IP1 Synonyms:ARL6IP, KIAA0069

Expression Region:1-203

Sequence Info:full length protein

30 other products in the same category: