View larger

Recombinant Salmonella typhimurium Glycerol-3-phosphate acyltransferase(plsY)

CSB-CF353691SXB

Recombinant Salmonella typhimurium Glycerol-3-phosphate acyltransferase(plsY)

See below for Detailed Description

More details

CAD$1,549.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Uniprot NO.:P67161

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): G3P acyltransferase Short name= GPAT EC= 2.3.1.15 EC= 2.3.1.n5 Lysophosphatidic acid synthase Short name= LPA synthase

Gene Names:Name:plsY Synonyms:ygiH Ordered Locus Names:STM3207

Expression Region:1-203

Sequence Info:full length protein

30 other products in the same category: