View larger

Recombinant Yarrowia lipolytica Protein SYM1(SYM1)

CSB-CF731984YAP

Recombinant Yarrowia lipolytica Protein SYM1(SYM1)

See below for Detailed Description

More details

CAD$1,548.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Uniprot NO.:Q6CAW5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNWYVRLLQKYPYRMAVTSTSSLFMIGDCVSQRYFSDKPYEPMRTARAGIYACAFAPAMT AWFRFLGQQQLPVIAKVAIDQAVFAPSSIGYYFSVMGLLEGKSPDTIWQSLKNQYWDTLK CGWMIWPAFQLFNFGIVPPNFRVLASNCCGLVWNTFLAYQNANKMEKGHVADLVIEEVKE EVKEVKQEVLAEVKVIKGFVKQ

Protein Names:Recommended name: Protein SYM1

Gene Names:Name:SYM1 Ordered Locus Names:YALI0C23815g

Expression Region:1-202

Sequence Info:full length protein

30 other products in the same category: