View larger

Recombinant Dechloromonas aromatica Probable intracellular septation protein A(Daro_2903)

CSB-CF674038DAAH

Recombinant Dechloromonas aromatica Probable intracellular septation protein A(Daro_2903)

See below for Detailed Description

More details

CAD$1,548.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Dechloromonas aromatica (strain RCB)

Uniprot NO.:Q47BZ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLFDLFPVILFFATFKYAEKSPELAASWMGSLLGFVPDDIKLAPILLATVVVIAATVA QIIWVHFRHGKVDKMLWVSLVLVVVFGGLTLAFQNEAFIKWKPTILYWVFAGSMIFSAFI LKKNPIKAMLGEQLTLPEPVWGKVNLSWIGFFLFMGALNLFVAFNFPTDTWVNFKLFGGM GLMLVFVLGQGMLLSKYVEEEK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Daro_2903

Expression Region:1-202

Sequence Info:full length protein

30 other products in the same category: