View larger

Recombinant Rhodobacter sphaeroides Prolipoprotein diacylglyceryl transferase(lgt)

CSB-CF521904RLE

Recombinant Rhodobacter sphaeroides Prolipoprotein diacylglyceryl transferase(lgt)

See below for Detailed Description

More details

CAD$1,548.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)

Uniprot NO.:O33551

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYIPFPDISPELFSIELFGVTFALRWYALAYIAGLLIGWRLVLRMIRAERLWSFGPPMT EDQLERLLTWVILGVILGGRLGFVLFYQPAHYLAHPLDILKVWEGGMSFHGGFLGVMTAL VAFCLKERISILPVADLLAAATPPGLFLGRIANFINAELWGRPTTLPWGVAFPGEAAQSC PGIEGICARHPSQIYEAGLEGI

Protein Names:Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.-

Gene Names:Name:lgt Synonyms:umpA

Expression Region:1-202

Sequence Info:full length protein

30 other products in the same category: