View larger

Recombinant Escherichia coli Inner membrane protein ynbA(ynbA)

CSB-CF304326ENV

Recombinant Escherichia coli Inner membrane protein ynbA(ynbA)

See below for Detailed Description

More details

CAD$1,547.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P76090

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLYQIKPLFQSLLRPTMFWLYKHHVTANHITLAALALSLLTGLLLMLAAQPILFLLLPI VLFIRMALNALDGMLARECNQQTRLGAILNETGDVISDIALYLPFLFLPESNASLVILML FCTILTEFCGLLAQTINGVRSYAGPFGKSDRALIFGLWGLAVAIYPQWMQWNNLLWSIAS ILLLWTAINRCRSVLLMSAEI

Protein Names:Recommended name: Inner membrane protein ynbA

Gene Names:Name:ynbA Ordered Locus Names:b1408, JW1405

Expression Region:1-201

Sequence Info:full length protein

30 other products in the same category: