View larger

Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 3(qoxC)

CSB-CF679929SBAH

Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 3(qoxC)

See below for Detailed Description

More details

CAD$1,547.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus haemolyticus (strain JCSC1435)

Uniprot NO.:Q4L563

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSHDTNTVDSRTHEGQLNKLGFWIFLTAEFSLFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLISSYTCGISIYYMRKEKQNLMMFWMILTVLLGLVFVGFEIYEFAHYVSE GVTPQIGSYWSSFFILLGTHGAHVSLGIGWIICLLIQVATRGLNKYNAPKLFIVSLYWHF LDVVWIFIFTAVYMIGMVYSG

Protein Names:Recommended name: Probable quinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Quinol oxidase polypeptide III

Gene Names:Name:qoxC Ordered Locus Names:SH1903

Expression Region:1-201

Sequence Info:full length protein

30 other products in the same category: