View larger

Recombinant Musa acuminata CASP-like protein MA4_106O17.50(MA4_106O17.50)

CSB-CF627344MVB

Recombinant Musa acuminata CASP-like protein MA4_106O17.50(MA4_106O17.50)

See below for Detailed Description

More details

CAD$1,547.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Musa acuminata (Banana) (Musa cavendishii)

Uniprot NO.:Q1EPG7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESQFRPGFDVSQGAGGRASKFGDVVAPTSSTQLPGIILRIVAIVLTFISAVVMGAARQT TTVTGIDAETALLTSITVTVKSTYSAAYVYFVVANVLVFFYSVVSLVLSMVNKARLTSMS LPFSIADLLMVVLLFSSNGAAAAISVVAEKGQQNLAGWDKICNLFGGLCARVNAAIVLSM LASVAYVILVVFGMANLRRSQ

Protein Names:Recommended name: CASP-like protein MA4_106O17.50

Gene Names:ORF Names:MA4_106O17.50

Expression Region:1-201

Sequence Info:full length protein

30 other products in the same category: