View larger

Recombinant Rhodobacter sphaeroides Glycerol-3-phosphate acyltransferase(plsY)

CSB-CF388340RIJ

Recombinant Rhodobacter sphaeroides Glycerol-3-phosphate acyltransferase(plsY)

See below for Detailed Description

More details

CAD$1,547.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Uniprot NO.:A3PN50

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPAIESGLWALILTGVLGYLLGSIPFGIVITRALGLGDLRKIGSGNIGATNVLRTGNKPA ALATLLLDSGKGAIAVLIARAAVGEDAAQLAAFTSFLGHLFPVWLGFRGGKGVATFLGTL LALAWPVGLACCLTWLATAALGRISSLSALVAAASGVLWMILLGYGQMAALGAVLAVLIF IRHHANIRRILAGTEPRIGKK

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati

Gene Names:Name:plsY Ordered Locus Names:Rsph17029_2664

Expression Region:1-201

Sequence Info:full length protein

30 other products in the same category: