View larger

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 3(At3g43630)

CSB-CF878674DOA

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 3(At3g43630)

See below for Detailed Description

More details

CAD$1,546.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M2C3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESHNTLNLDMEKDQEKAFDYSKRAQWLRAAVLGANDGLVSTASLMMGVGAVKQNVKIMI LTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQMKRETGGEIEKEKLPSPTQAAAASALAF SLGAMVPLLAAAFVKEYKVRIGAIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLVGGWL AMAITYGFTKLIGSHSHMYV

Protein Names:Recommended name: Vacuolar iron transporter homolog 3 Alternative name(s): Protein NODULIN-LIKE 3

Gene Names:Ordered Locus Names:At3g43630 ORF Names:F22J12.3

Expression Region:1-200

Sequence Info:full length protein

30 other products in the same category: