View larger

Recombinant Uncharacterized membrane protein Mb1436 (Mb1436)

CSB-CF354397MVH

Recombinant Uncharacterized membrane protein Mb1436 (Mb1436)

See below for Detailed Description

More details

CAD$1,546.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium bovis

Uniprot NO.:P64838

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLQPAFKASMAVLLAAAAVAHPIGRERRWLVPALLLSATGDWLLAIPWWTWAFVFGLGAF LLAHLCFIGALLPLARQAAPSRGRVAAVVAMCVASAGLLVWFWPHLGKDNLTIPVTVYIV ALSAMVCTALLARLPTIWTAVGAVCFAASDSMIGIGRFILGNEALAVPIWWSYAAAEILI TAGFFFGREVPDNAAAPTDS

Protein Names:Recommended name: Uncharacterized membrane protein Mb1436

Gene Names:Ordered Locus Names:Mb1436

Expression Region:1-200

Sequence Info:full length protein

30 other products in the same category: