View larger

Recombinant Thellungiella halophila CASP-like protein 1

CSB-CF515210TMF

Recombinant Thellungiella halophila CASP-like protein 1

See below for Detailed Description

More details

CAD$1,545.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thellungiella halophila (Salt cress)

Uniprot NO.:E4MWF4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYLGVGLSPVNVAGTKMKLMDRKVRLTELILRCSVCALALVAAILIATDTQVKEIFTIQ KKAKYTDMKALVFLVVVNGIAAAYSLLHMVRCVVGMMKGSVLFSKPLAWAIFSGDQAIAY LTVAGVAAAAQSAAFAKLGEPELQWMKICTIYGKFCNQVGEGIATALLASIGMVLISSIS AFALFRLYGGNKAQQGSRW

Protein Names:Recommended name: CASP-like protein 1

Gene Names:

Expression Region:1-199

Sequence Info:full length protein

30 other products in the same category: