View larger

Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_763057 (POPTRDRAFT_763057)

CSB-CF496204EXS

Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_763057 (POPTRDRAFT_763057)

See below for Detailed Description

More details

CAD$1,545.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Uniprot NO.:B9HBX2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKSESAAIDIPESSSVAKGKAPLIAVSRNEKGGYRKGIAIFDFILRLAAIATALAAAAAM GTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIVRPHAVGPR LLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQKVSGAVVASFI TVVIFVFLIVLSAFALRRH

Protein Names:Recommended name: Casparian strip membrane protein POPTRDRAFT_763057

Gene Names:ORF Names:POPTRDRAFT_763057

Expression Region:1-199

Sequence Info:full length protein

30 other products in the same category: