View larger

Recombinant Salmonella arizonae Sulfoxide reductase heme-binding subunit YedZ(yedZ)

CSB-CF434789STE

Recombinant Salmonella arizonae Sulfoxide reductase heme-binding subunit YedZ(yedZ)

See below for Detailed Description

More details

CAD$1,545.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Uniprot NO.:A9MNV6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLTAKQIIWLKVCLHLVGFLPLLWLFWAINQGGLSADPVKDIQHFTGRTALKFLLATLL ISPLARYAKQPLLIRTRRLLGLWCFVWATLHLTSYALLELGIHNLALLGSELISRPYLTL GIISWLALLALTLTSTQFAQRKLGKRWQTLHNVVYLVAILAPVHYLWSVKVLSPQPVIYA ALALVLLALRYRKFRQWRR

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:SARI_04255

Expression Region:1-199

Sequence Info:full length protein

30 other products in the same category: