View larger

Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP23(TVP23)

CSB-CF409768STA

Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP23(TVP23)

See below for Detailed Description

More details

CAD$1,545.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Uniprot NO.:A6ZY50

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIW GVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSV PGFENLSRLANIQSFFQRQ

Protein Names:Recommended name: Golgi apparatus membrane protein TVP23 Alternative name(s): TLG2 compartment vesicle protein of 23 kDa

Gene Names:Name:TVP23 ORF Names:SCY_0988

Expression Region:1-199

Sequence Info:full length protein

30 other products in the same category: