View larger

Recombinant Escherichia coli Putative undecaprenyl-diphosphatase ybjG(ybjG)

CSB-CF301157ENV

Recombinant Escherichia coli Putative undecaprenyl-diphosphatase ybjG(ybjG)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P75806

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLENLNLSLFSLINATPDSAPWMISLAIFIAKDLITVVPLLAVVLWLWGLTAQRQLVIKI AIALAVSLFVSWTMGHLFPHDRPFVENIGYNFLHHAADDSFPSDHGTVIFTFALAFLCWH RLWSGSLLMVLAVVIAWSRVYLGVHWPLDMLGGLLAGMIGCLSAQIIWQAMGHKLYQRLQ SWYRVCFALPIRKGWVRD

Protein Names:Recommended name: Putative undecaprenyl-diphosphatase ybjG EC= 3.6.1.27 Alternative name(s): Undecaprenyl pyrophosphate phosphatase

Gene Names:Name:ybjG Ordered Locus Names:b0841, JW5112

Expression Region:1-198

Sequence Info:full length protein

30 other products in the same category: