View larger

Recombinant Deinococcus radiodurans Glycerol-3-phosphate acyltransferase 1(plsY1)

CSB-CF874271DJA

Recombinant Deinococcus radiodurans Glycerol-3-phosphate acyltransferase 1(plsY1)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Uniprot NO.:Q9RSV1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLTALLALLLSYLIGAIPAAAWLARARGVDIRKVGSGNSGATNVLRSLGKGPALLVASF DILKGVLAVLLARALGLSAEWAALCGVLAVIGHNFSPFLAFRGGKGVATSFGVIAILDPV LGLTTFVLAIACMWLTRFVSAGSIMGAFIAGALVLVLPRPTWDRAAVLFLAALLVWQHRE NIRKLQAGTERRLGEKVS

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 1 Alternative name(s): Acyl-PO4 G3P acyltransferase 1 Acyl-phosphate--glycerol-3-phosphate acyltransferase 1 G3P acyltransferase 1 Short name= GPAT 1 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY1 Ordered Locus Names:DR_2021

Expression Region:1-198

Sequence Info:full length protein

30 other products in the same category: