View larger

Recombinant Bacillus thuringiensis subsp. konkukian Glycerol-3-phosphate acyltransferase 2(plsY2)

CSB-CF757042BAAE

Recombinant Bacillus thuringiensis subsp. konkukian Glycerol-3-phosphate acyltransferase 2(plsY2)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus thuringiensis subsp. konkukian (strain 97-27)

Uniprot NO.:Q6HFJ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGTNTFRTLGKKAGFTVTIA DILKGTLATSLPMVFGLDIHPLWFGLAAVLGHVYPIFAKFRGGKAVATSAGVLLCYSPVV FAILAVVFFTLLFTTRYVSLSSMVTAVVAVIASIVSGDKIFIIAMCLLASMVIYKHRANI GRIINKTEPKANFSKKQK

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 2 Alternative name(s): Acyl-PO4 G3P acyltransferase 2 Acyl-phosphate--glycerol-3-phosphate acyltransferase 2 G3P acyltransferase 2 Short name= GPAT 2 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY2 Ordered Locus Names:BT9727_3361

Expression Region:1-198

Sequence Info:full length protein

30 other products in the same category: