View larger

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0480(MJ0480)

CSB-CF688056MRU

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0480(MJ0480)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Uniprot NO.:Q57904

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFGSIFDIYYKTLDAIFMPIIKVLHPALAILIIAIIVSLIINIATKLLVDQKRVAELKKE IQEFQVKFKKMSKNPEMMEKLQEEQQRIMQLNAELMKMSFRPMIYTWVPIILIFIYLRHV YGFGGVYQELNPGWNGVVVYLPIILSKILFIDFWHWLGSIFYKGGFKIVSNTALGWLGWY ILCSFATSTVLRKILGIK

Protein Names:Recommended name: Uncharacterized protein MJ0480

Gene Names:Ordered Locus Names:MJ0480

Expression Region:1-198

Sequence Info:full length protein

30 other products in the same category: