View larger

Recombinant Rhodococcus sp. Lipoprotein signal peptidase(lspA)

CSB-CF608189RLO

Recombinant Rhodococcus sp. Lipoprotein signal peptidase(lspA)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodococcus sp. (strain RHA1)

Uniprot NO.:Q0SHT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDDERVSQDPTAENETDAEDRNDDDPSGSAPPQPVTHQRRLLLFVIAGVVLATDLLTKIL AVANIEPGRPVWLIGDIVSLRLVRNPGAAFSMATGMTWLLTLVAVGVVIGVVRIGRTLRS PWWALGLGLVLGGALGNLVDRFFRAPGVMQGHVVDFVSVGWWPVFNVADSGIVCGAILLV VLTLIGLEPDGTRKGVEK

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:RHA1_ro01073

Expression Region:1-198

Sequence Info:full length protein

30 other products in the same category: