View larger

Recombinant Mouse Phosphatidylethanolamine N-methyltransferase(Pemt)

CSB-CF017780MO

Recombinant Mouse Phosphatidylethanolamine N-methyltransferase(Pemt)

See below for Detailed Description

More details

CAD$1,544.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q61907

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SWLLGYMDPTEPSFVAAVITIVFNPLFWNVVARWEQRTRKLSRAFGSPHLACYSLGICIL LLNILRSHCFTQAMMSQPKMEGLDNHTTYFLGLAFLGWGFVFVLSSFYALGFTGTFLGDY FGILKESRVTTFPFSVLDNPMYWGSTANYLGWALMHASPTGLLLTVVVAIVNVVALLYEE PFTAEIYRQKATRLHKRS

Protein Names:Recommended name: Phosphatidylethanolamine N-methyltransferase Short name= PEAMT Short name= PEMT EC= 2.1.1.17 Alternative name(s): PEMT2

Gene Names:Name:Pemt Synonyms:Pempt, Pemt2

Expression Region:2-199

Sequence Info:full length protein

30 other products in the same category: