View larger

Recombinant Pseudomonas aeruginosa Uncharacterized protein PA0392 (PA0392)

CSB-CF333057EZX

Recombinant Pseudomonas aeruginosa Uncharacterized protein PA0392 (PA0392)

See below for Detailed Description

More details

CAD$1,543.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:P25254

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFIVRATKPLLNPLRRIIP GFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIWSIIAVTSLFLKVFFFALI ISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGGLDLSPIFAFLALKLIDMLVI NNLAAMTGMPQQLSIFL

Protein Names:Recommended name: Uncharacterized protein PA0392

Gene Names:Ordered Locus Names:PA0392

Expression Region:1-197

Sequence Info:full length protein

30 other products in the same category: