View larger

Recombinant Drosophila melanogaster ARL-6-interacting protein 1 homolog(CG10326)

CSB-CF893743DLU

Recombinant Drosophila melanogaster ARL-6-interacting protein 1 homolog(CG10326)

See below for Detailed Description

More details

CAD$1,543.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9VES1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAASQVDQKRALNKLKHDLEPFRTAIVGAYGVLTWEKQYYAGVVFGVISCLYLVLWYLDL SLITLLSLLGVISILLNYAFPMVSRLIFGGVNWDGDQEAKFEDVCGQVCAVKGSLVVWYE YLFNERKSTVFVIVMSLGLLAMAWIGAIINNLLLMYLATLLILMWPGLQNKDIFKAITQR ASKIINEKIQCGKRKLQ

Protein Names:Recommended name: ARL-6-interacting protein 1 homolog

Gene Names:ORF Names:CG10326

Expression Region:1-197

Sequence Info:full length protein

30 other products in the same category: