View larger

Recombinant Chromatium vinosum K(+)-insensitive pyrophosphate-energized proton pump(hppA)

CSB-CF819790DTD

Recombinant Chromatium vinosum K(+)-insensitive pyrophosphate-energized proton pump(hppA)

See below for Detailed Description

More details

CAD$1,543.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chromatium vinosum (Allochromatium vinosum)

Uniprot NO.:Q8VNU8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AGGIAEMSGLPEDVRKTTDALDAVGNTTKAVTKGYAIGSAGLAALVLFADYTHNLEVAGK MQVFSLSDPAVIIGLFIGGLVPYLFGAMAMEAVGRAAGSVVIEVRRQFREIKGIMEGTAK PDYSRAVDLLTKAAIKEMVVPSLLPILVPVAVAIGMNILMGDGAGIRALGGMLIGTIVTG LFVAISMCTGGGAWDNA

Protein Names:Recommended name: K(+)-insensitive pyrophosphate-energized proton pump EC= 3.6.1.1 Alternative name(s): Membrane-bound proton-translocating pyrophosphatase Pyrophosphate-energized inorganic pyrophosphatase Short name= H(+)-PPase

Gene Names:Name:hppA Synonyms:vppA

Expression Region:1-197

Sequence Info:full length protein

30 other products in the same category: