View larger

Recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

CSB-CF387198AUU

Recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic

See below for Detailed Description

More details

CAD$1,543.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Angiopteris evecta (Mule's foot fern) (Polypodium evectum)

Uniprot NO.:A2T386

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MILPEPIHKVILVIIELGILLGSLGVVLLTNIVYSALLLGLVFICISLLYLVLNADFVAA AQVLIYVGAVNVLTVFAVMLIDKPKNITLFSFSNVGDNITLGVCTSLFILLTIMIPDASW SEIYMTKQSTKFVEQGLTTDVQLIGSQLLTKFLLPFELLSILLLVALIGAITIARQERIV EIDDNKASESKEDLSLF

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 6 NADH-plastoquinone oxidoreductase subunit 6

Gene Names:Name:ndhG

Expression Region:1-197

Sequence Info:full length protein

30 other products in the same category: