View larger

Recombinant Magnetococcus sp. Probable intracellular septation protein A (Mmc1_3451)

CSB-CF370486MNG

Recombinant Magnetococcus sp. Probable intracellular septation protein A (Mmc1_3451)

See below for Detailed Description

More details

CAD$1,543.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Magnetococcus sp. (strain MC-1)

Uniprot NO.:A0LD93

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRFALELLAIVVFFVVYKLDGIYSATAALIIMVLLNVFYHWFKHRHVPSMMWITLILVML FGGATLIFHDPLFIKWKPSILQWVLASGFLASHLIGKRVLVARMLDNQISMPSLHWRRLN AAWVLFLLFSGALNLYVAYTFSEEIWVSFKLFGLMGLTILFLIGQAFYMSRHGSEVRVEE RKEGMIEAEETVENRPE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Mmc1_3451

Expression Region:1-197

Sequence Info:full length protein

30 other products in the same category: