View larger

Recombinant Bacillus subtilis Spore maturation protein A(spmA)

CSB-CF339534BRJ

Recombinant Bacillus subtilis Spore maturation protein A(spmA)

See below for Detailed Description

More details

CAD$1,542.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P35157

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVNIIWVSLTVIGLVFAMCNGTLQDVNEAVFKGAKEAITISFGLMSVLVFWLGLMKIAEQ SGLLDIFSRMCRPFISKLFPDIPPDHPAMGYILSNLMANFFGLGNAATPLGIKAMEQMKK LNGNRSEASRSMITFLAVNTSCITLIPTTVIAVRMAYSSKTPTDIVGPSILATLISGIGA IIIDRYFYYRRKKKGR

Protein Names:Recommended name: Spore maturation protein A

Gene Names:Name:spmA Synonyms:ypuJ Ordered Locus Names:BSU23180

Expression Region:1-196

Sequence Info:full length protein

30 other products in the same category: