View larger

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 2(At1g76800)

CSB-CF890410DOA

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 2(At1g76800)

See below for Detailed Description

More details

CAD$1,542.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SRD3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQSGSNTNMDIEKESTTFDYSKRSQWLRAAVLGANDGLVSTASLMMGVGAVKHDVKAMI LSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQMERDSVEIEKEKLPSPMQAAAASALAFS AGAIVPLLAAAFVKEYKMRIISVVVAVTVALMVFGWLGAALGKAPAVRSSARVLFGGWLA MAVTFGLTKLIGLYGL

Protein Names:Recommended name: Vacuolar iron transporter homolog 2 Alternative name(s): Protein NODULIN-LIKE 2

Gene Names:Ordered Locus Names:At1g76800 ORF Names:F28O16.17

Expression Region:1-196

Sequence Info:full length protein

30 other products in the same category: