View larger

Recombinant Kluyveromyces lactis Golgi apparatus membrane protein TVP23(TVP23)

CSB-CF724764KBK

Recombinant Kluyveromyces lactis Golgi apparatus membrane protein TVP23(TVP23)

See below for Detailed Description

More details

CAD$1,541.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Uniprot NO.:Q6CTK9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPLFQLPMLPSFA NLDRVTRLQSFFTRS

Protein Names:Recommended name: Golgi apparatus membrane protein TVP23

Gene Names:Name:TVP23 Ordered Locus Names:KLLA0C11869g

Expression Region:1-195

Sequence Info:full length protein

30 other products in the same category: