View larger

Recombinant Oryza sativa subsp. japonica CASP-like protein Os02g0177700(Os02g0177700, LOC_Os02g08110)

CSB-CF718834OFG

Recombinant Oryza sativa subsp. japonica CASP-like protein Os02g0177700(Os02g0177700, LOC_Os02g08110)

See below for Detailed Description

More details

CAD$1,541.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryza sativa subsp. japonica (Rice)

Uniprot NO.:Q6ETN2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAATTAAAAVPGVVRAERLLRGGCVVMAATAALLLGFSAETKTVLFVRKTAVAKDVQALW VLTVAAAAAAGYQFAQLVRCMYCSSSGDAGAMAVAWTSFLLDKGCAYVVFASTAAALQAC MVGLIGVEALQWSKLCNIYTRFCEQAAAGMLCSFLAAAGMAVLSAFSARRLFRLYSPAGH RRSCPRAAVLATSPH

Protein Names:Recommended name: CASP-like protein Os02g0177700

Gene Names:Ordered Locus Names:Os02g0177700, LOC_Os02g08110 ORF Names:P0504A05.25

Expression Region:1-195

Sequence Info:full length protein

30 other products in the same category: