View larger

Recombinant Candida albicans Protein SYM1(SYM1)

CSB-CF691382CZD

Recombinant Candida albicans Protein SYM1(SYM1)

See below for Detailed Description

More details

CAD$1,541.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Uniprot NO.:Q59Q43

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKYIFNRYNALLLRRPLITNMITTGLLVGGGDALAQFFFPNNDNNNLEQQPFDYLRNLRA IIYGSLIFAPIGDKWYKFLNTKVVWTRNAQKPQYQRSMSTLLRVMVDQLVFAPFIGIPLY YSSMTILENRQPFLDNIIDKFNTSWWITLKSNWLVWPLFQFFNFYLLPVQFRLLAVNIIS IGWNTYLSYVMHSQK

Protein Names:Recommended name: Protein SYM1

Gene Names:Name:SYM1 ORF Names:CaO19.21, CaO19.7692

Expression Region:1-195

Sequence Info:full length protein

30 other products in the same category: