Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)
Uniprot NO.:C6BRS7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLWIFWLVFAYFLGSIPFGLFIGKICCNCDIRTEGSKSTGATNVARLCGFKYGVAALVLD VAKGFVPVLMAYQYSHNWIFISLVAAAAVIGHVFSIFMDMKGGKAVATTIGVFLALAPVA TFYSIVFLLAVIALSGFVSMGSLTFAVALPFFTLVTGSVGMVPLACGMTVLLFWTHRENI RRLAKGQENSWKKKK
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Ordered Locus Names:Desal_1455
Expression Region:1-195
Sequence Info:full length protein