View larger

Recombinant Rhizobium leguminosarum bv. trifolii UPF0314 protein Rleg2_3744 (Rleg2_3744)

CSB-CF466915RKQ

Recombinant Rhizobium leguminosarum bv. trifolii UPF0314 protein Rleg2_3744 (Rleg2_3744)

See below for Detailed Description

More details

CAD$1,541.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. trifolii (strain WSM2304)

Uniprot NO.:B5ZTH0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAADAEYRVRHQSFWFVACLAVLVAQIVTEYLMGRVPICACGYVKLWEGGVNTSGNSQH LSDWYTPSHIIHGFLFYGLGHLVLRRKPLAAKLLLALFIESGWELLENSPLIIDRYRTAT IALDYYGDSILNSAMDTVFMCLGFFFASRAPVALTVAIAIFFEIFTGYVIRDNLTLNVVM LIWPVEAIKVWQGGV

Protein Names:Recommended name: UPF0314 protein Rleg2_3744

Gene Names:Ordered Locus Names:Rleg2_3744

Expression Region:1-195

Sequence Info:full length protein

30 other products in the same category: