View larger

Recombinant Colwellia psychrerythraea Probable intracellular septation protein A(CPS_2317)

CSB-CF677504CBAB

Recombinant Colwellia psychrerythraea Probable intracellular septation protein A(CPS_2317)

See below for Detailed Description

More details

CAD$1,540.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)

Uniprot NO.:Q482I0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQLFIEYFPLLIFFIINSIAGIYWATGSLIVAAFVQIFYYKIKKEKIPAKQWIIFGLIVV FGGLTIYLQNDAFLKWKVTIINAFFAAALLVSNTFFNKNIIKEFLAESLSLPENIWSRLN LAWALFFLFCSGLNYYIAFNYDLDTWVNFKVFGLTGLMFLFSITSILFLYKYLEVEEEIN DTDTINNEKTKEST

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:CPS_2317

Expression Region:1-194

Sequence Info:full length protein

30 other products in the same category: