View larger

Recombinant Paracoccus denitrificans UPF0314 protein Pden_1914 (Pden_1914)

CSB-CF373543PYC

Recombinant Paracoccus denitrificans UPF0314 protein Pden_1914 (Pden_1914)

See below for Detailed Description

More details

CAD$1,539.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Paracoccus denitrificans (strain Pd 1222)

Uniprot NO.:A1B3B4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISPRIMFTRRSAPYWATFLVIVLAALWLLWIGREPICTCGSVKLWHGETMSSESSQHIA DWYTPSHVIHGLVFYAALWLVAPRLSFGWRLAIATLVESAWEIVENSDAIIERYRAVTIS LDYYGDSVLNSVSDILAMVLGFVLAARLPVWASVAIVIGFEALTTWLIRDGLALNVLMLL WPLEAVRGWQAAL

Protein Names:Recommended name: UPF0314 protein Pden_1914

Gene Names:Ordered Locus Names:Pden_1914

Expression Region:1-193

Sequence Info:full length protein

30 other products in the same category: