View larger

Recombinant Sorghum bicolor Casparian strip membrane protein Sb06g018970 (Sb06g018970)

CSB-CF513654FJS

Recombinant Sorghum bicolor Casparian strip membrane protein Sb06g018970 (Sb06g018970)

See below for Detailed Description

More details

CAD$1,538.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sorghum bicolor (Sorghum) (Sorghum vulgare)

Uniprot NO.:C5Y9U6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKDVVIEHGESSKAPLVPAPVAAGVGRAVSIADVFLRFLSIVATIASAISMGTTNETLP FFTQFIQFEAKYSDLPSFTFFVAANAVVCTYLVLSIPLSIVHIIRPRARYSRLILVFFDA VMLALLTAGASAAAAIVYLAHKGNVRANWFAICQQFDSFCERISGSLIGSFAAMVLLIVL IFLSAFALARRH

Protein Names:Recommended name: Casparian strip membrane protein Sb06g018970

Gene Names:Ordered Locus Names:Sb06g018970

Expression Region:1-192

Sequence Info:full length protein

30 other products in the same category: