View larger

Recombinant Xenopus tropicalis Transmembrane protein 211(tmem211)

CSB-CF023805XBF

Recombinant Xenopus tropicalis Transmembrane protein 211(tmem211)

See below for Detailed Description

More details

CAD$1,537.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:A9UL59

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMVSCMGSLWVILSLILTLISGFSLMSSAWYKTDTISFGVFVHCIGPKNMPCNQTCIYYR TLEEIPDIFGKIAAVLLFGGWLLLSFGAVLVLSWTIIPVGLCQRRVCTPARYAQISAVVV TVLGLLVFPFNLHSEFARQICGSSFIYKSGDCCLGWGYMMAIVTVMLSCFLPFIGRYNLN EIKTKILLSKM

Protein Names:Recommended name: Transmembrane protein 211

Gene Names:Name:tmem211

Expression Region:1-191

Sequence Info:full length protein

30 other products in the same category: