View larger

Recombinant Deinococcus radiodurans Lipoprotein signal peptidase(lspA)

CSB-CF882698DJA

Recombinant Deinococcus radiodurans Lipoprotein signal peptidase(lspA)

See below for Detailed Description

More details

CAD$1,537.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Uniprot NO.:Q9RRU7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWPFSRQQNVSRILPIVPTAPRRFPVWFPAVLVLVLIALDQWLKAWALAHLQLNAPAIPV IPGVLDWELTFNTGAAWSMFSGSAVPLALGRILVGLGILSYLLWKPQGRFLTVVLSMIAA GAIGNSIDGLQRGQVTDMIHSPLLSAVTEAINGTRFPIFNIADMCVVGGTILLLVASLLP ERKREKAVPEA

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:DR_2388

Expression Region:1-191

Sequence Info:full length protein

30 other products in the same category: