View larger

Recombinant Neosartorya fumigata Golgi apparatus membrane protein tvp23(tvp23)

CSB-CF681251NGS

Recombinant Neosartorya fumigata Golgi apparatus membrane protein tvp23(tvp23)

See below for Detailed Description

More details

CAD$1,537.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Uniprot NO.:Q4WQJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQPLQAQQGELNWRLSAHPITLLFFLGFRTSALLMYLFGVLFIKNFVLVFILTLLLLSA DFYYLKNIAGRRLVGLRWWNEVNTATGDSHWVFESSDPATRTISATDKRFFWLSLYVTPA LWIGLAVLAIVRLSSVIWLSLVAIALVLTITNTVAFSRCDRFSQASTYANRAFGGNIVNN LAGGLLGRLFK

Protein Names:Recommended name: Golgi apparatus membrane protein tvp23

Gene Names:Name:tvp23 ORF Names:AFUA_4G13040

Expression Region:1-191

Sequence Info:full length protein

30 other products in the same category: