View larger

Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_75865 (SELMODRAFT_75865)

CSB-CF520435SYF

Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_75865 (SELMODRAFT_75865)

See below for Detailed Description

More details

CAD$1,537.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Selaginella moellendorffii (Spikemoss)

Uniprot NO.:D8QNV6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGAYDGAEAPRAAPASTAANSRPSRLLLLHSLLLRLVAVVVSILVIAVMVHAKQRVMIFK AEWDNSKAFVALVAISAICLGYSFLQFILSAFHLCSKSWKSPTKCWAWMNFIADQILTYA MLGAAAAAAELAYIAKNGSSRAQWQPICSTFNTFCTRAGASIILSFIAVLALANSSAISA YHLFRRPSSSV

Protein Names:Recommended name: CASP-like protein SELMODRAFT_75865

Gene Names:ORF Names:SELMODRAFT_75865

Expression Region:1-191

Sequence Info:full length protein

30 other products in the same category: