View larger

Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_182225 (PHYPADRAFT_182225)

CSB-CF433268EVD

Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_182225 (PHYPADRAFT_182225)

See below for Detailed Description

More details

CAD$1,537.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Physcomitrella patens subsp. patens (Moss)

Uniprot NO.:A9S848

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEAADSATNNSKDTHFYGKSRAENRRRSDAMLLLFRALTFSFSLAAVVVMGTNRYRINPQ LKVSWYDFEPYRYVLAVNAIICIYSFVETWLAVYTYLQGSYLLPEIFQVWFDYGHDQGFA YLLFSANSAGVAMAQLLQSGNTLIHGAYHCTEAGGYCTQARVSIALGFVAFLFLALSSLL TGLRVARWYLR

Protein Names:Recommended name: CASP-like protein PHYPADRAFT_182225

Gene Names:ORF Names:PHYPADRAFT_182225

Expression Region:1-191

Sequence Info:full length protein

30 other products in the same category: