View larger

Recombinant Aspergillus clavatus Golgi apparatus membrane protein tvp23(tvp23)

CSB-CF373026AVC

Recombinant Aspergillus clavatus Golgi apparatus membrane protein tvp23(tvp23)

See below for Detailed Description

More details

CAD$1,537.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)

Uniprot NO.:A1CIM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQPLQPQQGELNWRLSAHPITLLCFLGFRSSALLMYLFGVLFIKNFVLVFILTLLLLSA DFYYLKNIAGRRLVGLRWWNEVNTSTGDSHWVFESSDPTTRTITATDKRFFWLGLYITPA LWIGLAVLAIVTLSKIIWLSLVAIALILTITNTVAFSRCDRFGQASTFANRAFGGSIVSN ITGGLLGRLFK

Protein Names:Recommended name: Golgi apparatus membrane protein tvp23

Gene Names:Name:tvp23 ORF Names:ACLA_052040

Expression Region:1-191

Sequence Info:full length protein

30 other products in the same category: