View larger

Recombinant UPF0059 membrane protein CE1598(CE1598)

CSB-CF816634CQG

Recombinant UPF0059 membrane protein CE1598(CE1598)

See below for Detailed Description

More details

CAD$1,536.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Corynebacterium efficiens

Uniprot NO.:Q8FTH1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLVHVMLLSCGVAADAFACSIARGTAIRVNIIKRSLILAGIFGVFQALMPVIGWGIGYF FAELSFIRAIDHWVAFLLLAGVGAKMIWDAFHQDADVDVIDTGAVQLRPALILGLATSID ALAVGMGMAFVHAPIITLALAMGLTTFVLSLVGAWMGHHGGGRFGGWATVIGGLVLIGLG GNILFDHMLG

Protein Names:Recommended name: UPF0059 membrane protein CE1598

Gene Names:Ordered Locus Names:CE1598

Expression Region:1-190

Sequence Info:full length protein

30 other products in the same category: