View larger

Recombinant Neurospora crassa Golgi apparatus membrane protein tvp-23(tvp-23)

CSB-CF766445NHA

Recombinant Neurospora crassa Golgi apparatus membrane protein tvp-23(tvp-23)

See below for Detailed Description

More details

CAD$1,536.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Uniprot NO.:Q7SGB6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEATPTPGSLSWRLSSHPITLLTFLAFRSSSLLVYLFGLLFTDNLVMIFIITILLLAGDF YYLKNIAGRRLVGLRWWNEVDPNSGDSHWVFESSEPGTKIINATDSRFFWLAIYAQPLLW VVLAIVALFSLKFIWLPLVAIALVLTITNSLAFSRCDKFSQASNIAGTAFSSGNIAGNIA SNMVGRFFSR

Protein Names:Recommended name: Golgi apparatus membrane protein tvp-23

Gene Names:Name:tvp-23 ORF Names:NCU02733

Expression Region:1-190

Sequence Info:full length protein

30 other products in the same category: